RNASEH2A Antikörper (C-Term)

Produktnummer ABIN634223

Der Kaninchen Polyklonal Anti-RNASEH2A-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RNASEH2A in Proben von Human zu detektieren.

Kurzübersicht für RNASEH2A Antikörper (C-Term) (ABIN634223)

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNASEH2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RNASEH2A Antikörper

Bindungsspezifität: C-Term

Spezifität: RNASEH2 A antibody was raised against the C terminal of RNASEH2

Aufreinigung: Affinity purified

Immunogen: RNASEH2 A antibody was raised using the C terminal of RNASEH2 corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASEH2A Blocking Peptide, (ABIN937886), is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNASEH2A

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Andere Bezeichnung: RNASEH2A

Hintergrund: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Molekulargewicht: 33 kDa (MW of target protein)