RNASEH2A Antikörper (Middle Region)

Produktnummer ABIN630199

Produktdetails anti-RNASEH2A Antikörper

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNASEH2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RNASEH2 A antibody was raised against the middle region of RNASEH2

Aufreinigung: Purified

Immunogen: RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASEH2A Blocking Peptide, catalog no. 33R-1458, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNASEH2A

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Andere Bezeichnung: RNASEH2A (RNASEH2A Produkte)

Synonyme: 2400006P09Rik antikoerper, RNASEHI antikoerper, RNHIA antikoerper, RNHL antikoerper, zgc:56307 antikoerper, AGS4 antikoerper, JUNB antikoerper, ribonuclease H2 subunit A antikoerper, ribonuclease H2, large subunit antikoerper, ribonuclease H2, subunit A antikoerper, ribonuclease H2 subunit A L homeolog antikoerper, rnaseh2a antikoerper, RNASEH2A antikoerper, Rnaseh2a antikoerper, rnaseh2a.L antikoerper

Hintergrund: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Molekulargewicht: 33 kDa (MW of target protein)