Interleukin enhancer-binding factor 3 (ILF3) (N-Term) Antikörper

Produktnummer ABIN634215

Produktdetails

Target: Interleukin enhancer-binding factor 3 (ILF3)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ILF3 antibody was raised against the N terminal of ILF3

Aufreinigung: Affinity purified

Immunogen: ILF3 antibody was raised using the N terminal of ILF3 corresponding to a region with amino acids PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Anwendungsinformationen

Applikationshinweise: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ILF3 Blocking Peptide, catalog no. 33R-7393, is also available for use as a blocking control in assays to test for specificity of this ILF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Interleukin enhancer-binding factor 3 (ILF3)

Andere Bezeichnung: ILF3 (ILF3 Produkte)

Synonyme: CBTF antikoerper, DRBF antikoerper, DRBP76 antikoerper, MMP4 antikoerper, MPHOSPH4 antikoerper, MPP4 antikoerper, NF-AT-90 antikoerper, NF110 antikoerper, NF110b antikoerper, NF90 antikoerper, NF90a antikoerper, NF90b antikoerper, NFAR antikoerper, NFAR-1 antikoerper, NFAR2 antikoerper, TCP110 antikoerper, TCP80 antikoerper, MBII-26 antikoerper, ilf3 antikoerper, wu:fb37d07 antikoerper, wu:fb94b02 antikoerper, zgc:77030 antikoerper, 4F.1 antikoerper, cbtf122 antikoerper, ilf3-A antikoerper, ubp3 antikoerper, ubp4 antikoerper, xilf3 antikoerper, interleukin enhancer binding factor 3 antikoerper, interleukin enhancer binding factor 3b antikoerper, interleukin enhancer binding factor 3 S homeolog antikoerper, ILF3 antikoerper, Ilf3 antikoerper, ilf3b antikoerper, ilf3.S antikoerper

Hintergrund: ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity.

Molekulargewicht: 76 kDa (MW of target protein)

Pathways: M Phase