SET/TAF-I Antikörper (N-Term)
-
- Target Alle SET/TAF-I (SET) Antikörper anzeigen
- SET/TAF-I (SET) (SET Nuclear Oncogene (SET))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SET/TAF-I Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SET antibody was raised against the N terminal of SET
- Aufreinigung
- Affinity purified
- Immunogen
- SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
- Top Product
- Discover our top product SET Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SET Blocking Peptide, catalog no. 33R-3911, is also available for use as a blocking control in assays to test for specificity of this SET antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SET antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SET/TAF-I (SET) (SET Nuclear Oncogene (SET))
- Andere Bezeichnung
- SET (SET Produkte)
- Hintergrund
- SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- Apoptose
-