SET/TAF-I Antikörper (N-Term)

Produktnummer ABIN634191

Dieses Anti-SET/TAF-I-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SET/TAF-I in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SET/TAF-I Antikörper (N-Term) (ABIN634191)

Target: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SET/TAF-I Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SET/TAF-I Antikörper

Bindungsspezifität: N-Term

Spezifität: SET antibody was raised against the N terminal of SET

Aufreinigung: Affinity purified

Immunogen: SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SET Blocking Peptide, catalog no. 33R-3911, is also available for use as a blocking control in assays to test for specificity of this SET antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SET antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SET/TAF-I

Target: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Andere Bezeichnung: SET

Hintergrund: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: Apoptose