ANAPC10 Antikörper (N-Term)

Produktnummer ABIN634189

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ANAPC10 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ANAPC10 Antikörper (N-Term) (ABIN634189)

Target: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANAPC10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANAPC10 Antikörper

Bindungsspezifität: N-Term

Spezifität: ANAPC10 antibody was raised against the N terminal of ANAPC10

Aufreinigung: Affinity purified

Immunogen: ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANAPC10 Blocking Peptide, (ABIN5612054), is also available for use as a blocking control in assays to test for specificity of this ANAPC10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANAPC10

Target: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Andere Bezeichnung: ANAPC10

Hintergrund: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: M Phase