ANAPC10 Antikörper (N-Term)

Produktnummer ABIN634189

Produktdetails anti-ANAPC10 Antikörper

Target: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANAPC10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANAPC10 antibody was raised against the N terminal of ANAPC10

Aufreinigung: Affinity purified

Immunogen: ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANAPC10 Blocking Peptide, catalog no. 33R-6569, is also available for use as a blocking control in assays to test for specificity of this ANAPC10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANAPC10

Target: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Andere Bezeichnung: ANAPC10 (ANAPC10 Produkte)

Synonyme: APC10 antikoerper, DOC1 antikoerper, 1500026N15Rik antikoerper, A830003M23Rik antikoerper, CG11419 antikoerper, Dmel\\CG11419 antikoerper, ANAPC10 antikoerper, SPBC1E8.06 antikoerper, anapc10 antikoerper, MGC85037 antikoerper, DDBDRAFT_0202332 antikoerper, DDBDRAFT_0235160 antikoerper, DDB_0202332 antikoerper, DDB_0235160 antikoerper, anaphase promoting complex subunit 10 antikoerper, Anaphase Promoting Complex subunit 10 antikoerper, anaphase promoting complex subunit DOC1 antikoerper, anaphase-promoting complex subunit Apc10 antikoerper, anaphase promoting complex subunit antikoerper, predicted protein antikoerper, anaphase promoting complex subunit 10 S homeolog antikoerper, ANAPC10 antikoerper, Anapc10 antikoerper, APC10 antikoerper, DOC1 antikoerper, apc10 antikoerper, CAALFM_C107850CA antikoerper, anapc10 antikoerper, LOC692856 antikoerper, anapc10.S antikoerper, NAEGRDRAFT_66759 antikoerper

Hintergrund: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: M Phase