Retinoblastoma Binding Protein 4 Antikörper (N-Term)

Produktnummer ABIN634184

Der Kaninchen Polyklonal Anti-Retinoblastoma Binding Protein 4-Antikörper wurde für WB validiert. Er ist geeignet, Retinoblastoma Binding Protein 4 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Retinoblastoma Binding Protein 4 Antikörper (N-Term) (ABIN634184)

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoblastoma Binding Protein 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Retinoblastoma Binding Protein 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBBP4 antibody was raised against the N terminal of RBBP4

Aufreinigung: Affinity purified

Immunogen: RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBBP4 Blocking Peptide, (ABIN939251), is also available for use as a blocking control in assays to test for specificity of this RBBP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Retinoblastoma Binding Protein 4

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Andere Bezeichnung: RBBP4

Hintergrund: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Zellzyklus, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus