Retinoblastoma Binding Protein 4 Antikörper (C-Term)

Produktnummer ABIN3043920

Produktdetails anti-Retinoblastoma Binding Protein 4 Antikörper

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Bindungsspezifität: AA 395-425, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Retinoblastoma Binding Protein 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: EDNIMQVWQM AENIYNDEDP EGSVDPEGQG S

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: retinoblastoma binding protein 4
Protein Name: Histone-binding protein RBBP4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Retinoblastoma Binding Protein 4

Target: Retinoblastoma Binding Protein 4 (RBBP4)

Andere Bezeichnung: RBBP4 (RBBP4 Produkte)

Synonyme: NURF55 antikoerper, RBAP48 antikoerper, 154659_at antikoerper, 55 antikoerper, CAF-1 antikoerper, CAF1 antikoerper, CAF1-55 antikoerper, CAF1p55 antikoerper, CG4236 antikoerper, Caf-1 antikoerper, Caf1/p55 antikoerper, Caf1p55 antikoerper, Dmel\\CG4236 antikoerper, MSI1/RbAp48/CAC3/LIN-53 antikoerper, NURF antikoerper, NURF-55 antikoerper, Nurf antikoerper, Nurf 55 antikoerper, Nurf-55 antikoerper, Nurf55 antikoerper, P55 antikoerper, RbAp48 antikoerper, S(ls)3 antikoerper, caf-1 antikoerper, caf1 antikoerper, caf1 p55 antikoerper, d-CAF1 antikoerper, dCAF-1 antikoerper, dCAF-1 p55 antikoerper, dNURF antikoerper, p55 antikoerper, p55 CAF1 antikoerper, p55/NURF-55 antikoerper, p55CAF1 antikoerper, nurf55 antikoerper, rbap48 antikoerper, xrbbp4 antikoerper, mRbAp48 antikoerper, RBBP4 antikoerper, rbb4-2 antikoerper, zgc:55349 antikoerper, zgc:77854 antikoerper, wu:fb33a09 antikoerper, wu:fb40e10 antikoerper, RBBP-4 antikoerper, rbbp4 antikoerper, M4E13.110 antikoerper, M4E13_110 antikoerper, MULTICOPY SUPPRESSOR OF IRA1 3 antikoerper, NFC3 antikoerper, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3 antikoerper, RB binding protein 4, chromatin remodeling factor antikoerper, Chromatin assembly factor 1, p55 subunit antikoerper, retinoblastoma binding protein 4 antikoerper, retinoblastoma binding protein 4, chromatin remodeling factor antikoerper, retinoblastoma binding protein 4 L homeolog antikoerper, Transducin family protein / WD-40 repeat family protein antikoerper, retinoblastoma binding protein 4 S homeolog antikoerper, RBBP4 antikoerper, Caf1-55 antikoerper, rbbp4 antikoerper, Rbbp4 antikoerper, rbbp4.L antikoerper, MSI3 antikoerper, rbbp4.S antikoerper

Hintergrund: Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.

Synonyms: CAF I p48 antibody|CAF-1 subunit C antibody|CAF-I 48 kDa subunit antibody|CAF-I p48 antibody|Chromatin assembly factor 1 subunit C antibody|Chromatin assembly factor I p48 subunit antibody|Chromatin assembly factor/CAF 1 p48 subunit antibody|Histone-binding protein RBBP4 antibody|MSI1 protein homolog antibody|Nucleosome-remodeling factor subunit RBAP48 antibody|NURF55 antibody|RbAp 48 antibody| RBAP48 antibody|RBBP-4 antibody|RBBP4 antibody|RBBP4_HUMAN antibody|Retinoblastoma binding protein 4 antibody|Retinoblastoma binding protein p48 antibody|Retinoblastoma-binding protein 4 antibody|Retinoblastoma-binding protein p48 antibody

Gen-ID: 5928

UniProt: Q09028

Pathways: Zellzyklus, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus