RRM2 Antikörper (N-Term)

Produktnummer ABIN634182

Dieses Anti-RRM2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RRM2 in WB. Geeignet für Human.

Kurzübersicht für RRM2 Antikörper (N-Term) (ABIN634182)

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RRM2 Antikörper

Bindungsspezifität: N-Term

Spezifität: RRM2 antibody was raised against the N terminal of RRM2

Aufreinigung: Affinity purified

Immunogen: RRM2 antibody was raised using the N terminal of RRM2 corresponding to a region with amino acids PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRM2 Blocking Peptide, (ABIN5615963), is also available for use as a blocking control in assays to test for specificity of this RRM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRM2

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Andere Bezeichnung: RRM2

Hintergrund: RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases