KIF3B Antikörper (C-Term)

Produktnummer ABIN634133

Produktdetails anti-KIF3B Antikörper

Target: KIF3B (Kinesin Family Member 3B (KIF3B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF3 B antibody was raised against the C terminal of KIF3

Aufreinigung: Affinity purified

Immunogen: KIF3 B antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS

Anwendungsinformationen

Applikationshinweise: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF3B Blocking Peptide, catalog no. 33R-1426, is also available for use as a blocking control in assays to test for specificity of this KIF3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF3B

Target: KIF3B (Kinesin Family Member 3B (KIF3B))

Andere Bezeichnung: KIF3B (KIF3B Produkte)

Synonyme: FLA8 antikoerper, HH0048 antikoerper, KLP-11 antikoerper, AI854312 antikoerper, AW549267 antikoerper, mKIAA0359 antikoerper, kinesin family member 3B antikoerper, KIF3B antikoerper, Kif3b antikoerper

Hintergrund: The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.

Molekulargewicht: 85 kDa (MW of target protein)

Pathways: Hedgehog Signalweg, M Phase