Hexokinase 2 Antikörper (N-Term)

Produktnummer ABIN634132

Produktdetails anti-Hexokinase 2 Antikörper

Target: Hexokinase 2 (HK2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Hexokinase 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Hexokinase 2 antibody was raised against the N terminal of HK2

Aufreinigung: Affinity purified

Immunogen: Hexokinase 2 antibody was raised using the N terminal of HK2 corresponding to a region with amino acids GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Hexokinase 2 Blocking Peptide, catalog no. 33R-3606, is also available for use as a blocking control in assays to test for specificity of this Hexokinase 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Hexokinase 2

Target: Hexokinase 2 (HK2)

Andere Bezeichnung: Hexokinase 2 (HK2 Produkte)

Hintergrund: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway.

Molekulargewicht: 102 kDa (MW of target protein)

Pathways: PI3K-Akt Signalweg, Carbohydrate Homeostasis, Warburg Effekt