RANGAP1 Antikörper (N-Term)

Produktnummer ABIN634052

Der Kaninchen Polyklonal Anti-RANGAP1-Antikörper wurde für WB validiert. Er ist geeignet, RANGAP1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für RANGAP1 Antikörper (N-Term) (ABIN634052)

Target: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RANGAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RANGAP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RanGAP1 antibody was raised against the N terminal of RANGAP1

Aufreinigung: Affinity purified

Immunogen: RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RanGAP1 Blocking Peptide, (ABIN5615754), is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANGAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RANGAP1

Target: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Andere Bezeichnung: RanGAP1

Hintergrund: RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus