PDIA6 Antikörper (N-Term)

Produktnummer ABIN634007

Der Kaninchen Polyklonal Anti-PDIA6-Antikörper wurde für WB validiert. Er ist geeignet, PDIA6 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für PDIA6 Antikörper (N-Term) (ABIN634007)

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDIA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDIA6 Antikörper

Bindungsspezifität: N-Term

Spezifität: PDIA6 antibody was raised against the N terminal of PDIA6

Aufreinigung: Affinity purified

Immunogen: PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDIA6 Blocking Peptide, (ABIN939957), is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDIA6

Target: PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))

Andere Bezeichnung: PDIA6

Hintergrund: Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Cell RedoxHomeostasis