P4HB Antikörper (C-Term)
-
- Target Alle P4HB Antikörper anzeigen
- P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P4HB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- P4 HB antibody was raised against the C terminal of P4 B
- Aufreinigung
- Affinity purified
- Immunogen
- P4 HB antibody was raised using the C terminal of P4 B corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD
- Top Product
- Discover our top product P4HB Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
P4HB Blocking Peptide, catalog no. 33R-2152, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))
- Andere Bezeichnung
- P4HB (P4HB Produkte)
- Synonyme
- DSI antikoerper, ERBA2L antikoerper, GIT antikoerper, P4Hbeta antikoerper, PDI antikoerper, PDIA1 antikoerper, PHDB antikoerper, PO4DB antikoerper, PO4HB antikoerper, PROHB antikoerper, PDA2 antikoerper, PDIP antikoerper, PDIR antikoerper, ERp59 antikoerper, Pdia1 antikoerper, Thbp antikoerper, p55 antikoerper, XPDIp antikoerper, pdi antikoerper, 1810041F13Rik antikoerper, AI661267 antikoerper, Pdip antikoerper, Pdipl antikoerper, p58 antikoerper, prolyl 4-hydroxylase subunit beta antikoerper, protein disulfide isomerase family A member 2 antikoerper, prolyl 4-hydroxylase, beta polypeptide antikoerper, protein disulfide isomerase family A member 2 L homeolog antikoerper, protein disulfide isomerase associated 2 antikoerper, prolyl 4-hydroxylase subunit beta L homeolog antikoerper, protein disulfide-isomerase antikoerper, P4HB antikoerper, PDIA2 antikoerper, P4hb antikoerper, pdia2.L antikoerper, Pdia2 antikoerper, p4hb.L antikoerper, LOC8281065 antikoerper
- Hintergrund
- P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.
- Molekulargewicht
- 55 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism
-