P4HB Antikörper (C-Term)

Produktnummer ABIN633967

Produktdetails anti-P4HB Antikörper

Target: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P4HB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: P4 HB antibody was raised against the C terminal of P4 B

Aufreinigung: Affinity purified

Immunogen: P4 HB antibody was raised using the C terminal of P4 B corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

P4HB Blocking Peptide, catalog no. 33R-2152, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P4HB

Target: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Andere Bezeichnung: P4HB (P4HB Produkte)

Hintergrund: P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism