PLG Antikörper (Plasminogen) (Middle Region)

Details for Product anti-PLG Antibody No. ABIN633957
Antigen
  • wu:fb70e09
  • PLG
  • LPA
  • plg
  • Ab1-346
  • AI649309
  • Pg
  • plasminogen
  • plg
  • PLG
  • Plg
Epitop
Middle Region
6
6
5
5
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
314
94
64
5
3
3
2
2
2
1
1
Wirt
Kaninchen
183
116
44
35
11
Klonalität
Polyklonal
Konjugat
Dieser PLG Antikörper ist unkonjugiert
31
18
16
5
5
4
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
225
207
89
47
36
26
22
18
17
16
16
16
13
11
10
7
4
4
4
3
3
2
2
1
1
1
1
Optionen
Immunogen Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
Spezifität Plasminogen antibody was raised against the middle region of PLG
Reinigung Affinity purified
Plasmids, Primers & others Plasmide, Primers & weitere PLG products on genomics-online (e.g. as negative or positive controls)
Antigen
Andere Bezeichnung Plasminogen (PLG Antibody Abstract)
Hintergrund The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.
Molekulargewicht 88 kDa (MW of target protein)
Pathways Komplementsystem, Lipid Metabolism
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Plasminogen (PLG) (Middle Region) antibody (ABIN633957) Plasminogen antibody used at 1 ug/ml to detect target protein.
Produkt verwendet in: Giraud, Chabaud, Lejeune, Barbaria, Mallet: "The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." in: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, 2006 (PubMed).

Giraud, Dicristofaro, De Micco, Lejeune, Barbaria, Mallet: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." in: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, 2005 (PubMed).

Haben Sie etwas anderes gesucht?