PLG Antikörper (Plasminogen) (Middle Region)

Details for Product anti-PLG Antibody No. ABIN633957
Antigen
Epitop
Middle Region
7
6
4
4
4
4
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
300
90
55
3
3
2
1
1
1
Wirt
Kaninchen
172
114
42
33
11
Klonalität
Polyklonal
Konjugat
Dieser PLG Antikörper ist unkonjugiert
31
18
13
5
5
4
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
214
198
84
47
31
26
22
19
18
16
15
13
13
12
7
7
4
4
3
3
3
2
2
1
1
1
1
Optionen
Immunogen Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
Spezifität Plasminogen antibody was raised against the middle region of PLG
Reinigung Affinity purified
Antigen
Andere Bezeichnung Plasminogen (PLG Antibody Abstract)
Hintergrund The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.
Molekulargewicht 88 kDa (MW of target protein)
Pathways Komplementsystem, Lipid Metabolism
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Plasminogen (PLG) (Middle Region) antibody (ABIN633957) Plasminogen antibody used at 1 ug/ml to detect target protein.
Produkt verwendet in: Giraud, Chabaud, Lejeune, Barbaria, Mallet: "The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." in: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, 2006 (PubMed).

Giraud, Dicristofaro, De Micco, Lejeune, Barbaria, Mallet: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." in: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, 2005 (PubMed).