PLG Antikörper (Middle Region)
-
- Target Alle PLG Antikörper anzeigen
- PLG (Plasminogen (PLG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Plasminogen antibody was raised against the middle region of PLG
- Aufreinigung
- Affinity purified
- Immunogen
- Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
- Top Product
- Discover our top product PLG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." in: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).
: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." in: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, (2005) (PubMed).
: "
-
The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." in: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).
-
- Target
- PLG (Plasminogen (PLG))
- Andere Bezeichnung
- Plasminogen (PLG Produkte)
- Synonyme
- wu:fb70e09 antikoerper, PLG antikoerper, LPA antikoerper, plg antikoerper, Ab1-346 antikoerper, AI649309 antikoerper, Pg antikoerper, plasminogen antikoerper, plg antikoerper, PLG antikoerper, Plg antikoerper
- Hintergrund
- The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.
- Molekulargewicht
- 88 kDa (MW of target protein)
- Pathways
- Komplementsystem, Lipid Metabolism
-