GABRE Antikörper

Produktnummer ABIN633794

Produktdetails anti-GABRE Antikörper

Target: GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABRE antibody was raised using a synthetic peptide corresponding to a region with amino acids DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRE Blocking Peptide, catalog no. 33R-2229, is also available for use as a blocking control in assays to test for specificity of this GABRE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRE

Target: GABRE (gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE))

Andere Bezeichnung: GABRE (GABRE Produkte)

Synonyme: GABRE antikoerper, gamma-aminobutyric acid type A receptor epsilon subunit antikoerper, gamma-aminobutyric acid (GABA) A receptor, subunit epsilon antikoerper, GABRE antikoerper, Gabre antikoerper

Hintergrund: GABRE belongs to the ligand-gated ionic channel family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane