ASIC1 Antikörper (N-Term)

Produktnummer ABIN633632

Der Kaninchen Polyklonal Anti-ASIC1 Antikörper wurde für WB validiert. Er ist geeignet, ASIC1 in Proben von Maus, Human und Ratte zu detektieren.

Kurzübersicht für ASIC1 Antikörper (N-Term) (ABIN633632)

Target: ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASIC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASIC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACCN2 antibody was raised against the N terminal of ACCN2

Aufreinigung: Affinity purified

Immunogen: ACCN2 antibody was raised using the N terminal of ACCN2 corresponding to a region with amino acids MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACCN2 Blocking Peptide, (ABIN5611891), is also available for use as a blocking control in assays to test for specificity of this ACCN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASIC1

Target: ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))

Andere Bezeichnung: ACCN2

Hintergrund: ACCN2 is the cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. ACCN2 is also permeable for Ca2+, Li+ and K+. ACCN2 generates a biphasic current with a fast inactivating and a slow sustained phase. ACCN2 mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties.

Molekulargewicht: 65 kDa (MW of target protein)