ASIC1 Antikörper (N-Term)
Kurzübersicht für ASIC1 Antikörper (N-Term) (ABIN633632)
Target
Alle ASIC1 (ACCN2) Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- ACCN2 antibody was raised against the N terminal of ACCN2
-
Aufreinigung
- Affinity purified
-
Immunogen
- ACCN2 antibody was raised using the N terminal of ACCN2 corresponding to a region with amino acids MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
ACCN2 Blocking Peptide, (ABIN5611891), is also available for use as a blocking control in assays to test for specificity of this ACCN2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))
-
Andere Bezeichnung
- ACCN2
-
Hintergrund
- ACCN2 is the cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. ACCN2 is also permeable for Ca2+, Li+ and K+. ACCN2 generates a biphasic current with a fast inactivating and a slow sustained phase. ACCN2 mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties.
-
Molekulargewicht
- 65 kDa (MW of target protein)
Target
-