SNRPA1 Antikörper (Middle Region)

Produktnummer ABIN633565

Produktdetails anti-SNRPA1 Antikörper

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SNRPA antibody was raised against the middle region of SNRPA

Aufreinigung: Affinity purified

Immunogen: SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPA Blocking Peptide, catalog no. 33R-6281, is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Andere Bezeichnung: SNRPA (SNRPA Produkte)

Synonyme: Mud1 antikoerper, U1-A antikoerper, U1A antikoerper, im:7142962 antikoerper, zgc:101832 antikoerper, C430021M15Rik antikoerper, Rnu1a-1 antikoerper, Rnu1a1 antikoerper, mud1 antikoerper, snf antikoerper, fc19d01 antikoerper, wu:fc19d01 antikoerper, zgc:77810 antikoerper, T30B22.12 antikoerper, U1SNRNP-SPECIFIC PROTEIN antikoerper, spliceosomal protein U1A antikoerper, small nuclear ribonucleoprotein polypeptide A antikoerper, small nuclear ribonucleoprotein polypeptide A' antikoerper, small nuclear ribonucleoprotein polypeptide A S homeolog antikoerper, spliceosomal protein U1A antikoerper, SNRPA antikoerper, snrpa1 antikoerper, Snrpa antikoerper, snrpa.S antikoerper, snrpa antikoerper, U1A antikoerper

Hintergrund: SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.

Molekulargewicht: 31 kDa (MW of target protein)