DHX30 Antikörper

Produktnummer ABIN633367

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DHX30 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für DHX30 Antikörper (ABIN633367)

Target: DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHX30 Antikörper

Aufreinigung: Affinity purified

Immunogen: DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX30 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this DHX30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX30

Target: DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))

Andere Bezeichnung: DHX30

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.

Molekulargewicht: 129 kDa (MW of target protein)

Pathways: Chromatin Binding