DHX30 Antikörper
-
- Target Alle DHX30 Antikörper anzeigen
- DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX30 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
- Top Product
- Discover our top product DHX30 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX30 Blocking Peptide, catalog no. 33R-1151, is also available for use as a blocking control in assays to test for specificity of this DHX30 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX30 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 30 (DHX30))
- Andere Bezeichnung
- DHX30 (DHX30 Produkte)
- Synonyme
- DHX30 antikoerper, dhx30 antikoerper, DDX30 antikoerper, RETCOR antikoerper, 2810477H02Rik antikoerper, C130058C04Rik antikoerper, Ddx30 antikoerper, HELG antikoerper, Ret-CoR antikoerper, DExH-box helicase 30 antikoerper, DEAH (Asp-Glu-Ala-His) box helicase 30 antikoerper, DEAH-box helicase 30 antikoerper, DEAH-box helicase 30 S homeolog antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 30 antikoerper, DHX30 antikoerper, dhx30 antikoerper, dhx30.S antikoerper, Dhx30 antikoerper
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-