XPO1 Antikörper
-
- Target Alle XPO1 Antikörper anzeigen
- XPO1 (Exportin 1 (XPO1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser XPO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
- Top Product
- Discover our top product XPO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
XPO1 Blocking Peptide, catalog no. 33R-6744, is also available for use as a blocking control in assays to test for specificity of this XPO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XPO1 (Exportin 1 (XPO1))
- Andere Bezeichnung
- XPO1 (XPO1 Produkte)
- Synonyme
- CG13387 antikoerper, CRM1 antikoerper, Crm1 antikoerper, DCRM1 antikoerper, Dmel\\CG13387 antikoerper, Emb antikoerper, XPO-1 antikoerper, XPO1 antikoerper, Xpo1 antikoerper, crm1 antikoerper, dCRM1 antikoerper, l(2)k16715 antikoerper, 18.m06600 antikoerper, DDBDRAFT_0183812 antikoerper, DDBDRAFT_0234066 antikoerper, DDB_0183812 antikoerper, DDB_0234066 antikoerper, exportin-1 antikoerper, LOC100220104 antikoerper, emb antikoerper, exp1 antikoerper, Xpo antikoerper, AA420417 antikoerper, Exp1 antikoerper, embargoed antikoerper, exportin 1 antikoerper, putative exportin 1 antikoerper, chromosome region maintenance protein 1 antikoerper, exportin-1 antikoerper, exportin 1 (CRM1 homolog, yeast) antikoerper, exportin 1 S homeolog antikoerper, emb antikoerper, cgd3_3060 antikoerper, Tc00.1047053511725.150 antikoerper, Tb11.01.5940 antikoerper, BBOV_II007220 antikoerper, LMJF_32_1100 antikoerper, xpo1 antikoerper, Xpo1 antikoerper, XPO1 antikoerper, LOC100165622 antikoerper, LOC100633509 antikoerper, xpo1.S antikoerper
- Hintergrund
- XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.
- Molekulargewicht
- 123 kDa (MW of target protein)
- Pathways
- M Phase
-