DDX58 Antikörper

Produktnummer ABIN633253

Produktdetails anti-DDX58 Antikörper

Target: DDX58 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX58 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DDX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX58 Blocking Peptide, catalog no. 33R-2340, is also available for use as a blocking control in assays to test for specificity of this DDX58 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX58 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX58

Target: DDX58 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58 (DDX58))

Andere Bezeichnung: DDX58 (DDX58 Produkte)

Synonyme: RIG-I antikoerper, RIGI antikoerper, RLR-1 antikoerper, 6430573D20Rik antikoerper, C330021E21 antikoerper, RHIV-1 antikoerper, RIG-1 antikoerper, DExD/H-box helicase 58 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 antikoerper, DEXD/H-box helicase 58 antikoerper, DDX58 antikoerper, Ddx58 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure.

Molekulargewicht: 106 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Hepatitis C