DCK Antikörper (Middle Region)

Produktnummer ABIN632979

Produktdetails anti-DCK Antikörper

Target: DCK (Deoxycytidine Kinase (DCK))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DCK antibody was raised against the middle region of DCK

Aufreinigung: Affinity purified

Immunogen: DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCK Blocking Peptide, catalog no. 33R-1569, is also available for use as a blocking control in assays to test for specificity of this DCK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCK

Target: DCK (Deoxycytidine Kinase (DCK))

Andere Bezeichnung: DCK (DCK Produkte)

Synonyme: dck antikoerper, DCK antikoerper, wu:fc15f06 antikoerper, zgc:101771 antikoerper, dck1 antikoerper, deoxycytidine kinase antikoerper, deoxycytidine kinase, gene 2 L homeolog antikoerper, deoxycytidine kinase, gene 2 antikoerper, Deoxycytidine kinase antikoerper, deoxycytidine kinase, gene 1 L homeolog antikoerper, DCK antikoerper, dck antikoerper, dck.2.L antikoerper, dck.2 antikoerper, Dck antikoerper, FPV059 antikoerper, FPV151 antikoerper, dck.1.L antikoerper

Hintergrund: Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Molekulargewicht: 30 kDa (MW of target protein)