RAGE Antikörper (N-Term)

Produktnummer ABIN632910

Dieses Anti-RAGE-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RAGE in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RAGE Antikörper (N-Term) (ABIN632910)

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAGE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAGE Antikörper

Bindungsspezifität: N-Term

Spezifität: RAGE antibody was raised against the N terminal of RAGE

Aufreinigung: Affinity purified

Immunogen: RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAGE Blocking Peptide, (ABIN5615742), is also available for use as a blocking control in assays to test for specificity of this RAGE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAGE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAGE

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Andere Bezeichnung: RAGE

Hintergrund: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteine