PHLDA3 Antikörper (N-Term)
-
- Target Alle PHLDA3 Antikörper anzeigen
- PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHLDA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PHLDA3 antibody was raised against the N terminal of PHLDA3
- Aufreinigung
- Affinity purified
- Immunogen
- PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC
- Top Product
- Discover our top product PHLDA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHLDA3 Blocking Peptide, catalog no. 33R-5324, is also available for use as a blocking control in assays to test for specificity of this PHLDA3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))
- Andere Bezeichnung
- PHLDA3 (PHLDA3 Produkte)
- Synonyme
- TIH1 antikoerper, Tih1 antikoerper, si:dz182n13.5 antikoerper, zgc:92333 antikoerper, pleckstrin homology like domain family A member 3 antikoerper, pleckstrin homology like domain, family A, member 3 antikoerper, pleckstrin homology-like domain, family A, member 3 antikoerper, PHLDA3 antikoerper, Phlda3 antikoerper, phlda3 antikoerper
- Hintergrund
- PHLDA3 is a p53/TP53-regulated repressor of Akt/AKT1 signaling. It represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity.
- Molekulargewicht
- 14 kDa (MW of target protein)
-