PHLDA3 Antikörper (N-Term)

Produktnummer ABIN632801

Produktdetails anti-PHLDA3 Antikörper

Target: PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHLDA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PHLDA3 antibody was raised against the N terminal of PHLDA3

Aufreinigung: Affinity purified

Immunogen: PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHLDA3 Blocking Peptide, catalog no. 33R-5324, is also available for use as a blocking control in assays to test for specificity of this PHLDA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHLDA3

Target: PHLDA3 (Pleckstrin Homology-Like Domain, Family A, Member 3 (PHLDA3))

Andere Bezeichnung: PHLDA3 (PHLDA3 Produkte)

Synonyme: TIH1 antikoerper, Tih1 antikoerper, si:dz182n13.5 antikoerper, zgc:92333 antikoerper, pleckstrin homology like domain family A member 3 antikoerper, pleckstrin homology like domain, family A, member 3 antikoerper, pleckstrin homology-like domain, family A, member 3 antikoerper, PHLDA3 antikoerper, Phlda3 antikoerper, phlda3 antikoerper

Hintergrund: PHLDA3 is a p53/TP53-regulated repressor of Akt/AKT1 signaling. It represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity.

Molekulargewicht: 14 kDa (MW of target protein)