SENP2 Antikörper (Middle Region)

Produktnummer ABIN632554

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SENP2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SENP2 Antikörper (Middle Region) (ABIN632554)

Target: SENP2 (SUMO1/sentrin/SMT3 Specific Peptidase 2 (SENP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SENP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SENP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SENP2 antibody was raised against the middle region of SENP2

Aufreinigung: Affinity purified

Immunogen: SENP2 antibody was raised using the middle region of SENP2 corresponding to a region with amino acids RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SENP2 Blocking Peptide, (ABIN5616042), is also available for use as a blocking control in assays to test for specificity of this SENP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SENP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SENP2

Target: SENP2 (SUMO1/sentrin/SMT3 Specific Peptidase 2 (SENP2))

Andere Bezeichnung: SENP2

Hintergrund: SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Chromatin Binding