DMBT1 Antikörper (N-Term)

Produktnummer ABIN632489

Produktdetails anti-DMBT1 Antikörper

Target: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DMBT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DMBT1 antibody was raised against the N terminal of DMBT1

Aufreinigung: Affinity purified

Immunogen: DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DMBT1 Blocking Peptide, catalog no. 33R-8945, is also available for use as a blocking control in assays to test for specificity of this DMBT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DMBT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DMBT1

Target: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Andere Bezeichnung: DMBT1 (DMBT1 Produkte)

Synonyme: GP340 antikoerper, muclin antikoerper, CRP antikoerper, CRP-[a] antikoerper, CRP-[b] antikoerper, Crpd antikoerper, DBMT1 antikoerper, gp300 antikoerper, p80 antikoerper, DMBT1 antikoerper, gp340 antikoerper, deleted in malignant brain tumors 1 antikoerper, deleted in malignant brain tumors 1 protein antikoerper, gp340 antikoerper, deleted in malignant brain tumors 1 S homeolog antikoerper, DMBT1 antikoerper, Dmbt1 antikoerper, LOC100064515 antikoerper, dmbt1 antikoerper, ST201phi2-1p340 antikoerper, dmbt1.S antikoerper

Hintergrund: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

Molekulargewicht: 258 kDa (MW of target protein)

Pathways: Activation of Innate immune Response