Lactate Dehydrogenase A Antikörper (N-Term)

Produktnummer ABIN632309

Der Kaninchen Polyklonal Anti-Lactate Dehydrogenase A-Antikörper wurde für WB validiert. Er ist geeignet, Lactate Dehydrogenase A in Proben von Human zu detektieren.

Kurzübersicht für Lactate Dehydrogenase A Antikörper (N-Term) (ABIN632309)

Target: Lactate Dehydrogenase A (LDHA)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lactate Dehydrogenase A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Lactate Dehydrogenase A Antikörper

Bindungsspezifität: N-Term

Spezifität: LDHA antibody was raised against the N terminal of LDHA

Aufreinigung: Affinity purified

Immunogen: LDHA antibody was raised using the N terminal of LDHA corresponding to a region with amino acids ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LDHA Blocking Peptide, (ABIN936951), is also available for use as a blocking control in assays to test for specificity of this LDHA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lactate Dehydrogenase A

Target: Lactate Dehydrogenase A (LDHA)

Andere Bezeichnung: LDHA

Hintergrund: LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Warburg Effekt