ETF1 Antikörper (N-Term)

Produktnummer ABIN632229

Der Kaninchen Polyklonal anti-ETF1 Antikörper (ABIN632229) detektiert spezifisch ETF1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ETF1 Antikörper (N-Term) (ABIN632229)

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ETF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ETF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ETF1 antibody was raised against the N terminal of ETF1

Aufreinigung: Affinity purified

Immunogen: ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ETF1 Blocking Peptide, (ABIN939543), is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ETF1

Target: ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))

Andere Bezeichnung: ETF1

Hintergrund: Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.

Molekulargewicht: 49 kDa (MW of target protein)