Adenylate Kinase 2 Antikörper (Middle Region)

Produktnummer ABIN632012

Produktdetails anti-Adenylate Kinase 2 Antikörper

Target: Adenylate Kinase 2 (AK2)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AK2 antibody was raised against the middle region of AK2

Aufreinigung: Affinity purified

Immunogen: AK2 antibody was raised using the middle region of AK2 corresponding to a region with amino acids LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AK2 Blocking Peptide, catalog no. 33R-5044, is also available for use as a blocking control in assays to test for specificity of this AK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adenylate Kinase 2

Target: Adenylate Kinase 2 (AK2)

Andere Bezeichnung: AK2 (AK2 Produkte)

Synonyme: ADK-2 antikoerper, BcDNA:SD09634 antikoerper, CG3140 antikoerper, Dak2 antikoerper, Dmel\\CG3140 antikoerper, anon-Dak2 antikoerper, adk2 antikoerper, NV10896 antikoerper, wu:fb34f05 antikoerper, wu:fj80e03 antikoerper, ADK2 antikoerper, AK 2 antikoerper, Ak-2 antikoerper, D4Ertd220e antikoerper, MXI22.8 antikoerper, MXI22_8 antikoerper, Adenylate kinase 2 antikoerper, adenylate kinase 2 antikoerper, adenylate kinase antikoerper, adenylate kinase 2 S homeolog antikoerper, Adenylate kinase family protein antikoerper, Adk2 antikoerper, AK2 antikoerper, ak2 antikoerper, LOC100123971 antikoerper, ak2.S antikoerper, Ak2 antikoerper, AT5G50370 antikoerper

Hintergrund: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process