Adenylate Kinase 2 Antikörper (Middle Region)
-
- Target Alle Adenylate Kinase 2 (AK2) Antikörper anzeigen
- Adenylate Kinase 2 (AK2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Adenylate Kinase 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AK2 antibody was raised against the middle region of AK2
- Aufreinigung
- Affinity purified
- Immunogen
- AK2 antibody was raised using the middle region of AK2 corresponding to a region with amino acids LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
- Top Product
- Discover our top product AK2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AK2 Blocking Peptide, catalog no. 33R-5044, is also available for use as a blocking control in assays to test for specificity of this AK2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Adenylate Kinase 2 (AK2)
- Andere Bezeichnung
- AK2 (AK2 Produkte)
- Synonyme
- ADK-2 antikoerper, BcDNA:SD09634 antikoerper, CG3140 antikoerper, Dak2 antikoerper, Dmel\\CG3140 antikoerper, anon-Dak2 antikoerper, adk2 antikoerper, NV10896 antikoerper, wu:fb34f05 antikoerper, wu:fj80e03 antikoerper, ADK2 antikoerper, AK 2 antikoerper, Ak-2 antikoerper, D4Ertd220e antikoerper, MXI22.8 antikoerper, MXI22_8 antikoerper, Adenylate kinase 2 antikoerper, adenylate kinase 2 antikoerper, adenylate kinase antikoerper, adenylate kinase 2 S homeolog antikoerper, Adenylate kinase family protein antikoerper, Adk2 antikoerper, AK2 antikoerper, ak2 antikoerper, LOC100123971 antikoerper, ak2.S antikoerper, Ak2 antikoerper, AT5G50370 antikoerper
- Hintergrund
- Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-