MGMT Antikörper (Middle Region)

Produktnummer ABIN631949

Produktdetails anti-MGMT Antikörper

Target: MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MGMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MGMT antibody was raised against the middle region of MGMT

Aufreinigung: Affinity purified

Immunogen: MGMT antibody was raised using the middle region of MGMT corresponding to a region with amino acids ISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MGMT Blocking Peptide, catalog no. 33R-4170, is also available for use as a blocking control in assays to test for specificity of this MGMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MGMT

Target: MGMT (O6-Methylguanine-DNA-Methyltransferase (MGMT))

Andere Bezeichnung: MGMT (MGMT Produkte)

Hintergrund: MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.MGMT repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: DNA Reparatur, Positive Regulation of Response to DNA Damage Stimulus