FN3KRP Antikörper (N-Term)

Produktnummer ABIN631861

Produktdetails anti-FN3KRP Antikörper

Target: FN3KRP (Fructosamine 3 Kinase Related Protein (FN3KRP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FN3KRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FN3 KRP antibody was raised against the N terminal of FN3 RP

Aufreinigung: Affinity purified

Immunogen: FN3 KRP antibody was raised using the N terminal of FN3 RP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FN3KRP Blocking Peptide, catalog no. 33R-5857, is also available for use as a blocking control in assays to test for specificity of this FN3KRP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN0 RP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FN3KRP

Target: FN3KRP (Fructosamine 3 Kinase Related Protein (FN3KRP))

Andere Bezeichnung: FN3KRP (FN3KRP Produkte)

Synonyme: FN3KL antikoerper, FN3K-RP antikoerper, fn3k antikoerper, fn3kl antikoerper, MGC145992 antikoerper, DKFZP469K211 antikoerper, RGD1304570 antikoerper, zgc:101634 antikoerper, fructosamine 3 kinase related protein antikoerper, fructosamine-3-kinase-related protein antikoerper, FN3KRP antikoerper, Fn3krp antikoerper, fn3krp antikoerper

Hintergrund: FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.

Molekulargewicht: 34 kDa (MW of target protein)