TMPRSS3 Antikörper (N-Term)

Produktnummer ABIN631830

Dieses Anti-TMPRSS3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMPRSS3 in WB. Geeignet für Human.

Kurzübersicht für TMPRSS3 Antikörper (N-Term) (ABIN631830)

Target: TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMPRSS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMPRSS3 Antikörper

Bindungsspezifität: N-Term

Spezifität: TMPRSS3 antibody was raised against the N terminal of TMPRSS3

Aufreinigung: Affinity purified

Immunogen: TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMPRSS3 Blocking Peptide, (ABIN5616696), is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMPRSS3

Target: TMPRSS3 (Transmembrane Protease, Serine 3 (TMPRSS3))

Andere Bezeichnung: TMPRSS3

Hintergrund: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Sensory Perception of Sound