-
- Target Alle RAD17 Antikörper anzeigen
- RAD17
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAD17 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
- Top Product
- Discover our top product RAD17 Primärantikörper
-
anti-RAD17 (RAD17) (AA 1-584) antibody
RAD17 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) (AA 1-110) antibodyRAD17 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2G12 unconjugated
anti-RAD17 (RAD17) (AA 391-670) antibodyRAD17 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) (AA 1-270) antibodyRAD17 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) (AA 218-246) antibodyRAD17 Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB20035 unconjugated
anti-RAD17 (RAD17) (C-Term) antibodyRAD17 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) (AA 621-670) antibodyRAD17 Reaktivität: Human, Maus WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) (C-Term) antibodyRAD17 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) (C-Term) antibodyRAD17 Reaktivität: Human WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-RAD17 (RAD17) antibodyRAD17 Reaktivität: Human, Maus, Ratte WB, IF, IP, IHC (p) Wirt: Maus Monoclonal 3-10E-010 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAD17 Blocking Peptide, catalog no. 33R-6262, is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD17
- Andere Bezeichnung
- RAD17 (RAD17 Produkte)
- Hintergrund
- RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.
- Molekulargewicht
- 76 kDa (MW of target protein)
-
Sie sind hier:
