RAD17 Antikörper

Produktnummer ABIN631819

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch RAD17 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RAD17 Antikörper (ABIN631819)

Target: RAD17

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD17 Antikörper

Aufreinigung: Affinity purified

Immunogen: RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD17 Blocking Peptide, (ABIN5615727), is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD17

Target: RAD17

Andere Bezeichnung: RAD17

Hintergrund: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

Molekulargewicht: 76 kDa (MW of target protein)