DCK Antikörper (Middle Region)
-
- Target Alle DCK Antikörper anzeigen
- DCK (Deoxycytidine Kinase (DCK))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DCK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DCK antibody was raised against the middle region of DCK
- Aufreinigung
- Affinity purified
- Immunogen
- DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
- Top Product
- Discover our top product DCK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DCK Blocking Peptide, catalog no. 33R-7620, is also available for use as a blocking control in assays to test for specificity of this DCK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCK (Deoxycytidine Kinase (DCK))
- Andere Bezeichnung
- DCK (DCK Produkte)
- Hintergrund
- Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.
- Molekulargewicht
- 30 kDa (MW of target protein)
-