Peroxiredoxin 6 Antikörper (C-Term)

Produktnummer ABIN631527

Dieses Anti-Peroxiredoxin 6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Peroxiredoxin 6 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Peroxiredoxin 6 Antikörper (C-Term) (ABIN631527)

Target: Peroxiredoxin 6 (PRDX6)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Peroxiredoxin 6 Antikörper

Bindungsspezifität: C-Term

Spezifität: PRDX6 antibody was raised against the C terminal of PRDX6

Aufreinigung: Affinity purified

Immunogen: PRDX6 antibody was raised using the C terminal of PRDX6 corresponding to a region with amino acids VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRDX6 Blocking Peptide, (ABIN5615540), is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peroxiredoxin 6

Target: Peroxiredoxin 6 (PRDX6)

Andere Bezeichnung: PRDX6

Hintergrund: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell, it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Molekulargewicht: 25 kDa (MW of target protein)