ATG4A Antikörper

Produktnummer ABIN631439

Der Kaninchen Polyklonal anti-ATG4A Antikörper wird verwendet zum Nachweis von ATG4A in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ATG4A Antikörper (ABIN631439)

Target: ATG4A (Autophagy related 4A Cysteine Peptidase (ATG4A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATG4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATG4A Antikörper

Aufreinigung: Affinity purified

Immunogen: ATG4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATG4A Blocking Peptide, (ABIN937239), is also available for use as a blocking control in assays to test for specificity of this ATG4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATG4A

Target: ATG4A (Autophagy related 4A Cysteine Peptidase (ATG4A))

Andere Bezeichnung: ATG4A

Hintergrund: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Autophagie