Klotho Antikörper (N-Term)

Produktnummer ABIN631412

Der Kaninchen Polyklonal Anti-Klotho-Antikörper wurde für WB validiert. Er ist geeignet, Klotho in Proben von Human zu detektieren.

Kurzübersicht für Klotho Antikörper (N-Term) (ABIN631412)

Target: Klotho (KL)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Klotho Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Klotho Antikörper

Bindungsspezifität: N-Term

Spezifität: Klotho antibody was raised against the n terminal of KL

Aufreinigung: Affinity purified

Immunogen: Klotho antibody was raised using the N terminal of KL corresponding to a region with amino acids FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Klotho Blocking Peptide, (ABIN938398), is also available for use as a blocking control in assays to test for specificity of this Klotho antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Klotho

Target: Klotho (KL)

Andere Bezeichnung: Klotho

Hintergrund: This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF).

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hormone Activity, Growth Factor Binding