UMPS Antikörper (C-Term)

Produktnummer ABIN631243

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch UMPS in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für UMPS Antikörper (C-Term) (ABIN631243)

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UMPS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UMPS Antikörper

Bindungsspezifität: C-Term

Spezifität: UMPS antibody was raised against the C terminal of UMPS

Aufreinigung: Affinity purified

Immunogen: UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UMPS Blocking Peptide, (ABIN5616907), is also available for use as a blocking control in assays to test for specificity of this UMPS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMPS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UMPS

Target: UMPS (Uridine Monophosphate Synthetase (UMPS))

Andere Bezeichnung: UMPS

Hintergrund: OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process