CA8 Antikörper (Middle Region)
-
- Target Alle CA8 Antikörper anzeigen
- CA8 (Carbonic Anhydrase VIII (CA8))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CA8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Carbonic Anhydrase VIII antibody was raised against the middle region of CA8
- Aufreinigung
- Affinity purified
- Immunogen
- Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
- Top Product
- Discover our top product CA8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-9129, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CA8 (Carbonic Anhydrase VIII (CA8))
- Andere Bezeichnung
- Carbonic Anhydrase VIII (CA8 Produkte)
- Synonyme
- AW546993 antikoerper, Ca8 antikoerper, Cals antikoerper, Cals1 antikoerper, Carp antikoerper, wdl antikoerper, zgc:110118 antikoerper, CA-VIII antikoerper, CALS antikoerper, CAMRQ3 antikoerper, CARP antikoerper, carbonic anhydrase 8 antikoerper, carbonic anhydrase VIII antikoerper, CAH8 antikoerper, Car8 antikoerper, ca8 antikoerper, CA8 antikoerper
- Hintergrund
- CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.
- Molekulargewicht
- 33 kDa (MW of target protein)
-