CA8 Antikörper (N-Term)

Produktnummer ABIN629695

Produktdetails anti-CA8 Antikörper

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carbonic Anhydrase VIII antibody was raised against the N terminal of CA8

Aufreinigung: Purified

Immunogen: Carbonic Anhydrase VIII antibody was raised using the N terminal of CA8 corresponding to a region with amino acids YEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDC

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase VIII Blocking Peptide, catalog no. 33R-10083, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA8

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Andere Bezeichnung: Carbonic Anhydrase VIII (CA8 Produkte)

Synonyme: AW546993 antikoerper, Ca8 antikoerper, Cals antikoerper, Cals1 antikoerper, Carp antikoerper, wdl antikoerper, zgc:110118 antikoerper, CA-VIII antikoerper, CALS antikoerper, CAMRQ3 antikoerper, CARP antikoerper, carbonic anhydrase 8 antikoerper, carbonic anhydrase VIII antikoerper, CAH8 antikoerper, Car8 antikoerper, ca8 antikoerper, CA8 antikoerper

Hintergrund: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.

Molekulargewicht: 32 kDa (MW of target protein)