Arrestin 3 Antikörper (Middle Region)

Produktnummer ABIN631132

Produktdetails anti-Arrestin 3 Antikörper

Target: Arrestin 3 (ARRB2) (Arrestin, beta 2 (ARRB2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Arrestin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Arrestin B2 antibody was raised against the middle region of ARRB2

Aufreinigung: Affinity purified

Immunogen: Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Arrestin B2 Blocking Peptide, catalog no. 33R-8056, is also available for use as a blocking control in assays to test for specificity of this Arrestin B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARRB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Arrestin 3

Target: Arrestin 3 (ARRB2) (Arrestin, beta 2 (ARRB2))

Abstract: ARRB2 Produkte

Synonyme: ARRB2 antikoerper, arb2 antikoerper, arr2 antikoerper, arrestin antikoerper, barr2 antikoerper, betaarr2 antikoerper, ARB2 antikoerper, ARR2 antikoerper, BARR2 antikoerper, BARRES antikoerper, AI326910 antikoerper, AW122872 antikoerper, arrb2 antikoerper, zgc:64007 antikoerper, arrestin beta 2 antikoerper, arrestin, beta 2 antikoerper, arrestin beta 2 L homeolog antikoerper, arrestin, beta 2b antikoerper, ARRB2 antikoerper, arrb2 antikoerper, Arrb2 antikoerper, arrb2.L antikoerper, arrb2b antikoerper

Hintergrund: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling