Caveolin-1 Antikörper (N-Term)

Produktnummer ABIN631128

Dieses Anti-Caveolin-1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Caveolin-1 in WB. Geeignet für Human.

Kurzübersicht für Caveolin-1 Antikörper (N-Term) (ABIN631128)

Target: Caveolin-1 (CAV1) (Caveolin 1, Caveolae Protein, 22kDa (CAV1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Caveolin-1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Caveolin-1 Antikörper

Bindungsspezifität: N-Term

Spezifität: CAV1 antibody was raised against the N terminal of CAV1

Aufreinigung: Affinity purified

Immunogen: CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAV1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CAV1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAV1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Caveolin-1

Target: Caveolin-1 (CAV1) (Caveolin 1, Caveolae Protein, 22kDa (CAV1))

Andere Bezeichnung: CAV1

Hintergrund: The scaffolding protein CAV1 is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Signaling Events mediated by VEGFR1 and VEGFR2, Negative Regulation of Transporter Activity, VEGFR1 Specific Signals