TCL1A Antikörper (N-Term)
-
- Target Alle TCL1A Antikörper anzeigen
- TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TCL1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TCL1 A antibody was raised against the N terminal of TCL1
- Aufreinigung
- Affinity purified
- Immunogen
- TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
- Top Product
- Discover our top product TCL1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TCL1A Blocking Peptide, catalog no. 33R-5631, is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))
- Andere Bezeichnung
- TCL1A (TCL1A Produkte)
- Synonyme
- TCL1A antikoerper, Tcl1a antikoerper, TCL1 antikoerper, Tcl1 antikoerper, T-cell leukemia/lymphoma 1A antikoerper, T cell lymphoma breakpoint 1 antikoerper, TCL1A antikoerper, Tcl1 antikoerper, Tcl1a antikoerper
- Hintergrund
- TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
- Molekulargewicht
- 13 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-