TCL1A Antikörper (N-Term)

Produktnummer ABIN631022

Der Kaninchen Polyklonal Anti-TCL1A-Antikörper wurde für WB validiert. Er ist geeignet, TCL1A in Proben von Human zu detektieren.

Kurzübersicht für TCL1A Antikörper (N-Term) (ABIN631022)

Target: TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCL1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TCL1A Antikörper

Bindungsspezifität: N-Term

Spezifität: TCL1 A antibody was raised against the N terminal of TCL1

Aufreinigung: Affinity purified

Immunogen: TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCL1A Blocking Peptide, (ABIN5616535), is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCL1A

Target: TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))

Andere Bezeichnung: TCL1A

Hintergrund: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: Stem Cell Maintenance