ACO2 Antikörper (N-Term)

Produktnummer ABIN631018

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACO2 in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für ACO2 Antikörper (N-Term) (ABIN631018)

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACO2 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACO2 antibody was raised against the N terminal of ACO2

Aufreinigung: Affinity purified

Immunogen: ACO2 antibody was raised using the N terminal of ACO2 corresponding to a region with amino acids LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACO2 Blocking Peptide, catalog no. 33R-5311, is also available for use as a blocking control in assays to test for specificity of this ACO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Andere Bezeichnung: ACO2

Hintergrund: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.

Molekulargewicht: 82 kDa (MW of target protein)