PARP2 Antikörper

Produktnummer ABIN631010

Produktdetails anti-PARP2 Antikörper

Target: PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA

Anwendungsinformationen

Applikationshinweise: WB: 1.6 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARP2 Blocking Peptide, catalog no. 33R-5123, is also available for use as a blocking control in assays to test for specificity of this PARP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP2

Target: PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))

Andere Bezeichnung: PARP2 (PARP2 Produkte)

Synonyme: ADPRT2 antikoerper, ADPRTL2 antikoerper, ADPRTL3 antikoerper, ARTD2 antikoerper, PARP-2 antikoerper, pADPRT-2 antikoerper, Adprt2 antikoerper, Adprtl2 antikoerper, Aspartl2 antikoerper, C78626 antikoerper, cb996 antikoerper, adprtl2 antikoerper, ADPRT-2 antikoerper, APP antikoerper, ATPARP1 antikoerper, PARP1 antikoerper, POLY(ADP-RIBOSE) POLYMERASE antikoerper, POLY(ADP-RIBOSE) POLYMERASE 1 antikoerper, PP antikoerper, T14P8.19 antikoerper, T14P8_19 antikoerper, poly(ADP-ribose) polymerase antikoerper, poly(ADP-ribose) polymerase 2 antikoerper, poly(ADP-ribose) polymerase 2 antikoerper, poly (ADP-ribose) polymerase family, member 2 antikoerper, poly (ADP-ribose) polymerase 2 antikoerper, poly(ADP-ribose) polymerase 2 S homeolog antikoerper, poly(ADP-ribose) polymerase antikoerper, PARP2 antikoerper, Parp2 antikoerper, parp2 antikoerper, parp2.S antikoerper

Hintergrund: PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: DNA Reparatur