PARP2 Antikörper
-
- Target Alle PARP2 Antikörper anzeigen
- PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
- Top Product
- Discover our top product PARP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.6 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARP2 Blocking Peptide, catalog no. 33R-5123, is also available for use as a blocking control in assays to test for specificity of this PARP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP2 (Poly (ADP-Ribose) Polymerase 2 (PARP2))
- Andere Bezeichnung
- PARP2 (PARP2 Produkte)
- Hintergrund
- PARP2 contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of protein.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-