Lamin B2 Antikörper (N-Term)

Produktnummer ABIN630994

Produktdetails anti-Lamin B2 Antikörper

Target: Lamin B2 (LMNB2)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lamin B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lamin B2 antibody was raised against the N terminal of LMNB2

Aufreinigung: Affinity purified

Immunogen: Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lamin B2 Blocking Peptide, catalog no. 33R-5781, is also available for use as a blocking control in assays to test for specificity of this Lamin B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lamin B2

Target: Lamin B2 (LMNB2)

Andere Bezeichnung: Lamin B2 (LMNB2 Produkte)

Synonyme: lmnb2-a antikoerper, LMNB2 antikoerper, lmn2 antikoerper, lamb2 antikoerper, Lamin-L(II) antikoerper, LOC100136040 antikoerper, im:7142331 antikoerper, lamin antikoerper, wu:fb94e05 antikoerper, wu:fb95e12 antikoerper, wu:fc15d06 antikoerper, wu:fc49h03 antikoerper, lamin-b2 antikoerper, lmnb2 antikoerper, LAMB2 antikoerper, LMN2 antikoerper, RGD1563803 antikoerper, lamin B2 S homeolog antikoerper, lamin B2 antikoerper, lamin B2 L homeolog antikoerper, lmnb2.S antikoerper, LMNB2 antikoerper, lmnb2 antikoerper, lmnb2.L antikoerper, Lmnb2 antikoerper

Hintergrund: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Apoptose, Caspase Kaskade in der Apoptose