Lamin B2 Antikörper (N-Term)

Produktnummer ABIN630994

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Lamin B2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Lamin B2 Antikörper (N-Term) (ABIN630994)

Target: Lamin B2 (LMNB2)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lamin B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Lamin B2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Lamin B2 antibody was raised against the N terminal of LMNB2

Aufreinigung: Affinity purified

Immunogen: Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lamin B2 Blocking Peptide, (ABIN5614408), is also available for use as a blocking control in assays to test for specificity of this Lamin B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lamin B2

Target: Lamin B2 (LMNB2)

Andere Bezeichnung: Lamin B2

Hintergrund: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Apoptose, Caspase Kaskade in der Apoptose